Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD9, Mouse (Cell-Free, His)

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CD9 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd9-protein-mouse-cf-his.html

Purity

90.00

Smiles

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Molecular Formula

12527 (Gene_ID) P40240 (M1-V226) (Accession)

Molecular Weight

28.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCE1L Human Gene Knockout Kit (CRISPR)
KN425306 1 Kit

SYCE1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL2 Feline
OM296432-01 1 µg

IL2 Feline

Sign In for Pricing
View Details
IL2 Feline
OM296432-02 5 µg

IL2 Feline

Sign In for Pricing
View Details
IL2 Feline
OM296432-03 50 µg

IL2 Feline

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgD,  10nm
GAF-004-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgD, 10nm

Sign In for Pricing
View Details
Sytl3 Rabbit Polyclonal Antibody
TA363346 100 µL

Sytl3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details