Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD9, Mouse (Cell-Free, His)

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CD9 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd9-protein-mouse-cf-his.html

Purity

90.00

Smiles

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Molecular Formula

12527 (Gene_ID) P40240 (M1-V226) (Accession)

Molecular Weight

28.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG9 Antibody
KC-43799-01 50 μL

SMG9 Antibody

Sign In for Pricing
View Details
SMG9 Antibody
KC-43799-02 100 µL

SMG9 Antibody

Sign In for Pricing
View Details
SMG9 Antibody
KC-43799-03 1 mL

SMG9 Antibody

Sign In for Pricing
View Details
P3r3urf Mouse Gene Knockout Kit (CRISPR)
KN500146 1 Kit

P3r3urf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
hnRNP G (RBMX) Human Gene Knockout Kit (CRISPR)
KN400777 1 Kit

hnRNP G (RBMX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DGKB Polyclonal Antibody
E-AB-90198-01 60 µL

DGKB Polyclonal Antibody

Sign In for Pricing
View Details