Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGFR vIII, Human (HEK293, Fc)

The EGFR vIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, Fc) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EGFR vIII Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egfr-protein-human-hek-293-fc.html

Purity

97.06

Smiles

LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS

Molecular Formula

1956 (Gene_ID) NP_001333870 (L25-S378) (Accession)

Molecular Weight

Approximately 80-120 kDa, based on SDS-PAGE or Tris-Bis PAGE under reducing condition, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-01 5 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details
9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-02 10 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details
9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-03 25 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details
9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-04 50 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details
9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-05 100 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details
9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine
orb1908221-06 500 mg

9- (2-C-methyl-2,3,5-tri-O-benzoyl -β-D-ribofuranosyl) purine

Sign In for Pricing
View Details