Recombinant Human ApoD (C-6His)
Recombinant Human Apolipoprotein D is produced by our Mammalian expression system and the target gene encoding Gln21-Ser189 is expressed with a 6His tag at the C-terminus.
Product Specifications
CAS Number
9000-83-3
Shipping Conditions
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below.
Storage Conditions
Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt.
Reconstituted protein solution can be stored at 2-8°C for 2-7 days.
Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months.
Shelf Life
12 Months
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2311005 3x 1.0 µg
SUCLA2P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
PP49310-01 1 mg
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Sign In for Pricing
View Details PP49310-02 10 mg
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Sign In for Pricing
View Details PP49310-03 100 mg
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Sign In for Pricing
View Details