Question 1

What is the catalog number for Recombinant Human KLK5 (C-6His)?

Accepted Answer

The catalog number for Recombinant Human KLK5 (C-6His) is C415.

Question 2

What sizes are available for Recombinant Human KLK5 (C-6His)?

Accepted Answer

Recombinant Human KLK5 (C-6His) is available in the following size(s): 10 µg, 50 µg, 500 µg, 1 mg.

Question 3

How many pack sizes does Recombinant Human KLK5 (C-6His) come in?

Accepted Answer

Recombinant Human KLK5 (C-6His) is available in 4 different pack sizes.

Question 4

Is Recombinant Human KLK5 (C-6His) in stock?

Accepted Answer

Recombinant Human KLK5 (C-6His) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

Are there any special shipping requirements for Recombinant Human KLK5 (C-6His)?

Accepted Answer

Recombinant Human KLK5 (C-6His) is requires dry ice shipping.

Question 6

What is Recombinant Human KLK5 (C-6His) used for?

Accepted Answer

Recombinant Human Kallikrein 5 is produced by our Mammalian expression system and the target gene encoding Val23-Ser293 is expressed with a 6His tag at the C-terminus.

Question 7

Can I get a trial-size or discounted first order of this product?

Accepted Answer

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Question 8

Do you offer bulk or custom quantities of this product?

Accepted Answer

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Question 9

Do you provide a Certificate of Analysis (CoA) for this product?

Accepted Answer

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Recombinant Human KLK5 (C-6His)

Product Specifications

CAS Number

Shipping Conditions

Storage Conditions

Shelf Life

Available Sizes

Frequently Asked Questions

Explore Other Products

5′ ATTO-Rho6G / 3′ ECLIPSE (5 to 9 nmol)

2-Biphenylyl-13C6 Sulfate Potassium Salt

RPL7AP71 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

ZNF135 Rabbit Polyclonal Antibody (RBITC)

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

VPS24 Rabbit Monoclonal Antibody [KD Validation]