S100A10, Human (His)
S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
S100A10 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a10-protein-human-his.html
Purity
95.0
Smiles
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Molecular Formula
6281 (Gene_ID) P60903 (P2-K97) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Recombinant Human AP-1 complex subunit sigma-3 Protein, GST, E.coli-1mg
ARP-1 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 group F Member 2, NR2F2, ARP1, TFCOUP2, COUP TF2, COUPTF2) discontinued
ARP-1 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 group F Member 2, NR2F2, ARP1, TFCOUP2, COUP TF2, COUPTF2) discontinued
