Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10, Human (His)

S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a10-protein-human-his.html

Purity

95.0

Smiles

PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Molecular Formula

6281 (Gene_ID) P60903 (P2-K97) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Eukaryotic Translation Initiation Factor 3 Subunit B (EIF3B) ELISA Kit
MBS9929024 Inquire

Rabbit Eukaryotic Translation Initiation Factor 3 Subunit B (EIF3B) ELISA Kit

Ask
View Details
RT1-M1-4 (NM_001008850) Rat Tagged Lenti ORF Clone
RR209144L3 10 µg

RT1-M1-4 (NM_001008850) Rat Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Aldh9a1 shRNA (UAS) - Lentiviral mouseAldh9a1 shRNA (UAS, GFP) (25)
GTR15181184 1 Vial

Lentiviral mouse Aldh9a1 shRNA (UAS) - Lentiviral mouseAldh9a1 shRNA (UAS, GFP) (25)

Ask
View Details
SLC44A1 siRNA Oligos set (Human)
44201171 3x 5 nmol

SLC44A1 siRNA Oligos set (Human)

Ask
View Details
Lentiviral mouse Hpse shRNA (UAS) - Lentiviral mouse Hpse shRNA (UAS) plasmid
GTR15164251 1 Vial

Lentiviral mouse Hpse shRNA (UAS) - Lentiviral mouse Hpse shRNA (UAS) plasmid

Ask
View Details