Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14, Mouse (HEK293, His)

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS) . CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD14 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd14-protein-mouse-hek293-his.html

Purity

95.0

Smiles

MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLFV

Molecular Formula

12475 (Gene_ID) P10810/NP_033971.1 (S16-P345) (Accession)

Molecular Weight

Approximately 45-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Arginyl tRNA synthetase (RARS) (NM_002887) Human Tagged ORF Clone
RG201261 10 µg

Arginyl tRNA synthetase (RARS) (NM_002887) Human Tagged ORF Clone

Ask
View Details
Rabbit Polyclonal EED Antibody [DyLight 680]
NBP2-81819FR 0.1 mL

Rabbit Polyclonal EED Antibody [DyLight 680]

Ask
View Details
Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mousePde6g shRNA (UAS, GFP) (25)
GTR15233732 1 Vial

Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mousePde6g shRNA (UAS, GFP) (25)

Ask
View Details
LIPM (NM_001128215) Human Recombinant Protein
TP325684 20 µg

LIPM (NM_001128215) Human Recombinant Protein

Ask
View Details
AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (PE)
MBS6462809-01 0.2 mL

AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (PE)

Ask
View Details
AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (PE)
MBS6462809-02 5x 0.2 mL

AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (PE)

Ask
View Details