Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell leukemia virus 1 Envelope glycoprotein gp62 (env), partial

Product Specifications

Product Name Alternative

Env polyprotein

Abbreviation

Recombinant Human T-cell leukemia virus 1 env protein, partial

Gene Name

Env

UniProt

P03381

Expression Region

21-312aa

Organism

Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)

Target Sequence

DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

The surface protein attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane .The transmembrane protein acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.0 kDa

References & Citations

"Human adult T-cell leukemia virus: complete nucleotide sequence of the provirus genome integrated in leukemia cell DNA." Seiki M., Hattori S., Hirayama Y., Yoshida M.C. Proc. Natl. Acad. Sci. U.S.A. 80:3618-3622 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-PLCG 2 Rabbit pAb
GB11733-50 50 μL

Anti-PLCG 2 Rabbit pAb

Ask
View Details
Zinc Finger Protein 839 (ZNF839) Antibody
abx323029-01 50 µg

Zinc Finger Protein 839 (ZNF839) Antibody

Ask
View Details
Zinc Finger Protein 839 (ZNF839) Antibody
abx323029-02 100 µg

Zinc Finger Protein 839 (ZNF839) Antibody

Ask
View Details
Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit
MBS9352943-01 48 Well

Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit

Ask
View Details
Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit
MBS9352943-02 96 Well

Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit

Ask
View Details
Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit
MBS9352943-03 5x 96 Well

Bovine WD Repeat-Containing Protein 17 (WDR17) ELISA Kit

Ask
View Details