Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Met (O) 35) -Amyloid β-Protein (1-42)

(Met (O) 35) -Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met (O) 35) -Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met (O) 35) -Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD) [1].

Product Specifications

UNSPSC

12352209

Target

Amyloid-β

Type

Peptides

Related Pathways

Neuronal Signaling

Applications

Neuroscience-Neurodegeneration

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/met-o-35-amyloid-β-protein-1-42.html

Solubility

10 mM in DMSO

Smiles

[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA]

Molecular Formula

C203H311N55O61S

Molecular Weight

4530.04

References & Citations

[1]Bitan G, et al. A molecular switch in amyloid assembly: Met35 and amyloid beta-protein oligomerization. J Am Chem Soc. 2003 Dec 17;125 (50) :15359-65.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-01 0.02 mg (E-Coli)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-02 0.1 mg (E-Coli)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-03 0.02 mg (Yeast)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-04 0.1 mg (Yeast)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-05 1 mg (E-Coli)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)
MBS1134959-06 1 mg (Yeast)

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Sign In for Pricing
View Details