Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Met (O) 35) -Amyloid β-Protein (1-42)

(Met (O) 35) -Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met (O) 35) -Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met (O) 35) -Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD) [1].

Product Specifications

UNSPSC

12352209

Target

Amyloid-β

Type

Peptides

Related Pathways

Neuronal Signaling

Applications

Neuroscience-Neurodegeneration

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/met-o-35-amyloid-β-protein-1-42.html

Solubility

10 mM in DMSO

Smiles

[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA]

Molecular Formula

C203H311N55O61S

Molecular Weight

4530.04

References & Citations

[1]Bitan G, et al. A molecular switch in amyloid assembly: Met35 and amyloid beta-protein oligomerization. J Am Chem Soc. 2003 Dec 17;125 (50) :15359-65.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin Like Protein 6A (ACTL6A) Antibody
abx332266 100 µL

Actin Like Protein 6A (ACTL6A) Antibody

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (APC)
MBS6167389-01 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (APC)

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (APC)
MBS6167389-02 5x 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (APC)

Sign In for Pricing
View Details
Mcu Mouse shRNA Plasmid (Locus ID 215999)
TR510958 1 Kit

Mcu Mouse shRNA Plasmid (Locus ID 215999)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8 Antibody (AE3) [mFluor Violet 610 SE]
NB120-9287MFV610 0.1 mL

Mouse Monoclonal Cytokeratin 8 Antibody (AE3) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Genorise® Tissue RNA Extraction Kit 600
GR102006 600 Preparations

Genorise® Tissue RNA Extraction Kit 600

Sign In for Pricing
View Details