Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Non-structural protein 1 (NS)

Product Specifications

Product Name Alternative

NS1A

Abbreviation

Recombinant Influenza B virus Non-structural protein 1

Gene Name

NS

UniProt

P12600

Expression Region

1-281aa

Organism

Influenza B virus (strain B/Singapore/222/1979)

Target Sequence

MAENMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMNPSAGIEGFEPYCMKNFSNSNCPNYNWTDYPPTPGKCLDDIEEEPENVDDPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGKFLKHPNGYKTLSTLHRLNVYDQSGRLVAKLVATDDLTVEDEEDGHRILNSLFERFNEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly (A) and U6 snRNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly (A) and U6 snRNA.

Molecular Weight

34.2 kDa

References & Citations

"Influenza B virus evolution: co-circulating lineages and comparison of evolutionary pattern with those of influenza A and C viruses." Yamashita M., Krystal M., Fitch W.M., Palese P. Virology 163:112-122 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit
MBS2578006-01 24 Tests (Limit 1)

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit
MBS2578006-02 48 Tests

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit
MBS2578006-03 96 Tests

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit
MBS2578006-04 5x 96 Tests

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit
MBS2578006-05 10x 96 Tests

Human PECAM1/CD31 (Platelet/Endothelial Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
NDUFA9 Polyclonal Antibody, Cy5 Conjugated
bs-8301R-Cy5 100 µL

NDUFA9 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details