Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement factor H/CFH, Human (HEK293, His, solution)

Complement factor H/CFH Protein, Human (HEK293, His, solution) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].

Product Specifications

Product Name Alternative

Complement factor H/CFH Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-factor-h-cfh-protein-human-hek-293-his.html

Purity

98.0

Smiles

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

Molecular Formula

3075 (Gene_ID) P08603-2 (E19-L449) (Accession)

Molecular Weight

Approximately 48 kDa

References & Citations

[1]Cui T, et al. Human complement factor H is a novel diagnostic marker for lung adenocarcinoma. Int J Oncol. 2011;39 (1) :161-168.|[2]Mandal MN, et al. Complement factor H: spatial and temporal expression and localization in the eye. Invest Ophthalmol Vis Sci. 2006;47 (9) :4091-4097.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mt:ND2 Antibody
orb806705 2 mg

Mt:ND2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
orb41510-01 50 μL

PPIL2 Antibody

Sign In for Pricing
View Details
PPIL2 Antibody
orb41510-02 100 µL

PPIL2 Antibody

Sign In for Pricing
View Details
HOXD13 (NM_000523) Human Over-expression Lysate
LS003239-20ug 20 µg

HOXD13 (NM_000523) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Eapp shRNA (UAS) - Lentiviral mouse Eapp shRNA (UAS, iRFP) (25)
GTR15180014 1 Vial

Lentiviral mouse Eapp shRNA (UAS) - Lentiviral mouse Eapp shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Melatonin Related Receptor (GPR50) (NM_004224) Human Over-expression Lysate
LS009248 100 µg

Melatonin Related Receptor (GPR50) (NM_004224) Human Over-expression Lysate

Sign In for Pricing
View Details