RBP4, Canine (HEK293, His)
Selected Variant
HY-P76001-01
Size: 5 µg
RBP4 Protein is a member of the lipocalin family and the major transport protein of the hydrophobic molecule retinol, also known as vitamin A, in the circulation. RBP4 Protein, Canine (HEK293, His) is the recombinant canine-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
RBP4 Protein, Canine (HEK293, His), Canine, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp4-protein-canine-hek293-his.html
Purity
90.00
Smiles
ESDCRVSNFQVKKNFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGRMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPLEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSEPNTL
Molecular Formula
477775 (Gene_ID) XP_038295882 (E19-L201) (Accession)
Molecular Weight
Approximately 23 kDa
References & Citations
[1]Steinhoff JS, et al. Biological Functions of RBP4 and Its Relevance for Human Diseases. Front Physiol. 2021 Mar 11;12:659977.|[2]Tang H, et al. TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations. Bioinformatics. 2019 Feb 1;35 (3) :518-520.|[3]Burge S, et al. Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation. Database (Oxford) . 2012 Feb 1;2012:bar068.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882299-100 1x 100 µL
Estrogen Receptor, alpha (Marker of Estrogen Dependence) (ESR1/2299R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881491-100 1x 100 µL
PAX8 (Renal Cell Marker) (PAX8/1491), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881146-500 1x 500 µL
CD86 (C86/1146), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1975-100 1x 100 µL
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0460-500 1x 500 µL
CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741674-100 1x 100 µL
TNF-alpha (Tumor Necrosis Factor alpha), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details