RBP4, Canine (HEK293, His)
Selected Variant
HY-P76001-01
Size: 5 µg
RBP4 Protein is a member of the lipocalin family and the major transport protein of the hydrophobic molecule retinol, also known as vitamin A, in the circulation. RBP4 Protein, Canine (HEK293, His) is the recombinant canine-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
RBP4 Protein, Canine (HEK293, His), Canine, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp4-protein-canine-hek293-his.html
Purity
90.00
Smiles
ESDCRVSNFQVKKNFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGRMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPLEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSEPNTL
Molecular Formula
477775 (Gene_ID) XP_038295882 (E19-L201) (Accession)
Molecular Weight
Approximately 23 kDa
References & Citations
[1]Steinhoff JS, et al. Biological Functions of RBP4 and Its Relevance for Human Diseases. Front Physiol. 2021 Mar 11;12:659977.|[2]Tang H, et al. TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations. Bioinformatics. 2019 Feb 1;35 (3) :518-520.|[3]Burge S, et al. Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation. Database (Oxford) . 2012 Feb 1;2012:bar068.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A00822-1-Dylight550 100 µg
Anti-PKC delta/PRKCD Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details 
BNC472235-100 1x 100 µL
Crystallin Alpha B (CPTC-CRYAB-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
A10753-1-FITC 100 µg/Vial
Anti-HSPA4L Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details 
BNC880946-500 1x 500 µL
Double Stranded DNA (dsDNA) (AE-2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details