RBP4, Canine (HEK293, His)
RBP4 Protein is a member of the lipocalin family and the major transport protein of the hydrophobic molecule retinol, also known as vitamin A, in the circulation. RBP4 Protein, Canine (HEK293, His) is the recombinant canine-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
RBP4 Protein, Canine (HEK293, His), Canine, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp4-protein-canine-hek293-his.html
Purity
90.00
Smiles
ESDCRVSNFQVKKNFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGRMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPLEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSEPNTL
Molecular Formula
477775 (Gene_ID) XP_038295882 (E19-L201) (Accession)
Molecular Weight
Approximately 23 kDa
References & Citations
[1]Steinhoff JS, et al. Biological Functions of RBP4 and Its Relevance for Human Diseases. Front Physiol. 2021 Mar 11;12:659977.|[2]Tang H, et al. TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations. Bioinformatics. 2019 Feb 1;35 (3) :518-520.|[3]Burge S, et al. Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation. Database (Oxford) . 2012 Feb 1;2012:bar068.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244878-ML405 100 µL
COX6C (Cytochrome C Oxidase Subunit VIc) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
![Tide Fluor™ 8WS acid [TF8WS acid] *Near Infrared Emission*](https://cdn.genprice.uk/products/271/7359123/imageurl/2335-aat.webp)
2335-AAT 10 mg
Tide Fluor™ 8WS acid [TF8WS acid] *Near Infrared Emission*
Sign In for Pricing
View Details 
LV783671 1.0 µg DNA
RPS17P17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details