Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Collectrin/TMEM27, Human (HEK293, Fc)

Collectrin, also known as TMEM27, plays a key role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface trafficking and amino acid transporter activity. Suggested to facilitate the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Human (HEK293, Fc) is the recombinant human-derived Collectrin/TMEM27 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Collectrin/TMEM27 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/collectrin-tmem27-protein-human-hek293-fc.html

Purity

95.50

Smiles

ELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVP

Molecular Formula

57393 (Gene_ID) Q9HBJ8 (E15-P141) (Accession)

Molecular Weight

Approximately 54-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF488A conjugate, 0.1mg/mL
BNC882146-100 1x 100 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF405S conjugate, 0.1mg/mL
BNC042136-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF568 conjugate, 0.1mg/mL
BNC681171-100 1x 100 µL

CD34 (HPCA1/1171), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF740 conjugate, 0.1mg/mL
BNC740142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details