PDGF-AA, Mouse
PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.
Product Specifications
Product Name Alternative
PDGF-AA Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-aa-protein-mouse.html
Purity
97.00
Smiles
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Molecular Formula
18590 (Gene_ID) P20033 (S87-T211) (Accession)
Molecular Weight
Approximately 17-28.7 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.|[2]Wu LW, et al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2018 Sep 28:fj201800658R.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
406134-01 50 µL
BCAS3 (Breast Carcinoma-Amplified Sequence 3 Imported, GAOB1)
Sign In for Pricing
View Details 406134-02 100 µL
BCAS3 (Breast Carcinoma-Amplified Sequence 3 Imported, GAOB1)
Sign In for Pricing
View Details 