PDGF-AA, Mouse
PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.
Product Specifications
Product Name Alternative
PDGF-AA Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-aa-protein-mouse.html
Purity
97.00
Smiles
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Molecular Formula
18590 (Gene_ID) P20033 (S87-T211) (Accession)
Molecular Weight
Approximately 17-28.7 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.|[2]Wu LW, et al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2018 Sep 28:fj201800658R.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1008409 100 µL
Phospho-NUDC (Ser326) Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details Feline Leukemia Virus (FeLV) gp70 antigen 0.5 mL
Feline Leukemia Virus gp70 antigen
Sign In for Pricing
View Details 
RM-T162012-01 10 mg
Tryptophan EP Impurity L; N-Acetyltryptophan EP Impurity L
Sign In for Pricing
View Details