Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-AA, Mouse

PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

Product Specifications

Product Name Alternative

PDGF-AA Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-aa-protein-mouse.html

Purity

97.00

Smiles

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT

Molecular Formula

18590 (Gene_ID) P20033 (S87-T211) (Accession)

Molecular Weight

Approximately 17-28.7 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.|[2]Wu LW, et al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2018 Sep 28:fj201800658R.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEA-15 (D110) polyclonal antibody
orb642969-01 25 µL

PEA-15 (D110) polyclonal antibody

Sign In for Pricing
View Details
PEA-15 (D110) polyclonal antibody
orb642969-02 50 μL

PEA-15 (D110) polyclonal antibody

Sign In for Pricing
View Details
PEA-15 (D110) polyclonal antibody
orb642969-03 100 µL

PEA-15 (D110) polyclonal antibody

Sign In for Pricing
View Details
PEA-15 (D110) polyclonal antibody
orb642969-04 200 µL

PEA-15 (D110) polyclonal antibody

Sign In for Pricing
View Details
Olr1220 Protein Vector (Rat) (pPB-C-His)
PV287430 500 ng

Olr1220 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-CALU Antibody
MBS8324161-01 0.03 mL

Anti-CALU Antibody

Sign In for Pricing
View Details