Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Mouse (HEK293, Fc, solution)

HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) is the recombinant mouse-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-mouse-hek293-fc-solution.html

Purity

97.10

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Molecular Formula

15289 (Gene_ID) P63158 (M1-E215) (Accession)

Molecular Weight

Approximately 57 kDa

References & Citations

SSRN. 2024 Mar 26.|Cell Mol Biol Lett. 2024 May 16;29(1):75.|J Neuroimmunol. 2024 Jul 18:394:578403.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Citation 01

Acta Pharm Sin B. 2025 Apr;15 (4) :2077-2094.|Redox Biol. 2025 Sep 22:87:103877.|Sci Rep. 2025 Jun 6;15 (1) :19871.|Sci Rep. 2025 May 29;15 (1) :18853.|SSRN. 2024 Mar 26.|Cell Mol Biol Lett. 2024 May 16;29 (1) :75.|J Neuroimmunol. 2024 Jul 18:394:578403.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog