Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit anti-goat IgG HRP Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

[IgG]

Reactivity

Goat

Storage Conditions

Store at +4 °C after thawing. Aliquot store at-20 °C or-80 °C. Avoid repeated freeze/thaw cycles.

Specificity

This antibody is produced by immunizing rabbits with goat IgG.

Short Name

[IgG]

Other Product Names

[IgG]

NCBI GI Number

185362

NCBI Accession Number

AAA02914.1

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
PRRX2 Rabbit pAb
E45R28993N-100 100 µL

PRRX2 Rabbit pAb

Sign In for Pricing
View Details
Hyaluronan synthase 2 (HAS2) (NM_005328) Human Untagged Clone
SC116826 10 µg

Hyaluronan synthase 2 (HAS2) (NM_005328) Human Untagged Clone

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-01 0.05 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-02 0.1 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-03 5x 0.1 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details