Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family G member 2 (ABCG2), partial

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family G member 2 Breast cancer resistance protein CDw338 Mitoxantrone resistance-associated protein Placenta-specific ATP-binding cassette transporter Urate exporter CD_antigen: CD338

Abbreviation

Recombinant Human ABCG2 protein, partial

Gene Name

ABCG2

UniProt

Q9UNQ0

Expression Region

557-630aa

Organism

Homo sapiens (Human)

Target Sequence

NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells (PubMed:11306452, PubMed:12958161, PubMed:19506252, PubMed:20705604, PubMed:28554189, PubMed:30405239, PubMed:31003562) . Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme (PubMed:20705604, PubMed:23189181) . Also mediates the efflux of sphingosine-1-P from cells (PubMed:20110355) . Acts as a urate exporter functioning in both renal and extrarenal urate excretion (PubMed:19506252, PubMed:20368174, PubMed:22132962, PubMed:31003562) . In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate (By similarity) . Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates (PubMed:12682043, PubMed:28554189, PubMed:30405239) . Mediates the secretion of the riboflavin and biotin vitamins into milk (By similarity) . Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability (By similarity) . Plays an important role in the exclusion of xenobiotics from the brain (Probable) . It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux (PubMed:11306452, PubMed:12477054, PubMed:15670731, PubMed:18056989, PubMed:31254042) . In placenta, it limits the penetration of drugs from the maternal plasma into the fetus (By similarity) . May play a role in early stem cell self-renewal by blocking differentiation (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.1 kDa

References & Citations

"The ABC transporter Bcrp1/ABCG2 is expressed in a wide variety of stem cells and is a molecular determinant of the side-population phenotype." Zhou S., Schuetz J.D., Bunting K.D., Colapietro A.M., Sampath J., Morris J.J., Lagutina I., Grosveld G.C., Osawa M., Nakauchi H., Sorrentino B.P. Nat. Med. 7:1028-1034 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse FAS-associated factor 2 ELISA Kit
MBS2880240-01 48 Well

Mouse FAS-associated factor 2 ELISA Kit

Ask
View Details
Mouse FAS-associated factor 2 ELISA Kit
MBS2880240-02 96 Well

Mouse FAS-associated factor 2 ELISA Kit

Ask
View Details
Mouse FAS-associated factor 2 ELISA Kit
MBS2880240-03 5x 96 Well

Mouse FAS-associated factor 2 ELISA Kit

Ask
View Details
Mouse FAS-associated factor 2 ELISA Kit
MBS2880240-04 10x 96 Well

Mouse FAS-associated factor 2 ELISA Kit

Ask
View Details
KIF21A siRNA (Mouse)
MBS8205844-01 15 nmol

KIF21A siRNA (Mouse)

Ask
View Details
KIF21A siRNA (Mouse)
MBS8205844-02 30 nmol

KIF21A siRNA (Mouse)

Ask
View Details