Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA10, Cynomolgus (HEK293, His)

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EPHA10 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EPHA10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EPHA10 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha10-protein-cynomolgus-hek293-his.html

Purity

95.00

Smiles

EEVILLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRERVEPQSVSLSWREPIPAGAPGANGTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTPGEAASGSRDQSPA

Molecular Formula

102120465 (Gene_ID) XP_045230088.1 (E34-A565) (Accession)

Molecular Weight

Approximately 68-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
FY-AB53129-01 1 mL

Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Sign In for Pricing
View Details
Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
FY-AB53129-02 100 µL

Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Sign In for Pricing
View Details
Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
FY-AB53129-03 200 µL

Anti-Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Sign In for Pricing
View Details
Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT
E0062Hu-01 48 Well

Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT

Sign In for Pricing
View Details
Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT
E0062Hu-02 96 Well

Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT

Sign In for Pricing
View Details
Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT
E0062Hu-03 5x 96 Tests

Human B-Lymphocyte Chemoattractant 1, BLC-1 ELISA KIT

Sign In for Pricing
View Details