Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Haptoglobin, Human (HEK293, His)

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Haptoglobin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/haptoglobin-protein-human-hek-293-his.html

Purity

98.0

Smiles

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ&ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Molecular Formula

3240 (Gene_ID) P00738-1 (V19-Q160&I162-N406) (Accession)

Molecular Weight

16&40-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT3 (NM_012239) Human Over-expression Lysate
LY402174 100 µg

SIRT3 (NM_012239) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human PRKCG shRNA (UAS) - Lentiviral human PRKCG shRNA (UAS, RFP) plasmid
GTR15086521 1 Vial

Lentiviral human PRKCG shRNA (UAS) - Lentiviral human PRKCG shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IGFBP2 Antibody
A76273-50UL 50 μL

IGFBP2 Antibody

Sign In for Pricing
View Details
Inhibitor mmu-miR-362-3p AAV miRNA Vector
Amm3065900 500 ng

Inhibitor mmu-miR-362-3p AAV miRNA Vector

Sign In for Pricing
View Details
Ccl28 sgRNA CRISPR Lentivector set (Rat)
K7127101 3x 1.0 µg

Ccl28 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Tropomyosin β siRNA (h)
sc-43478 10 µM

Tropomyosin β siRNA (h)

Sign In for Pricing
View Details