Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-2/CXCL2, Mouse (HEK293)

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in HEK293.

Product Specifications

Product Name Alternative

MIP-2/CXCL2 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-2-cxcl2-protein-mouse-hek293.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 7.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46326121 3x 1.0µg DNA

TCEAL1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
MT-ND4L AAV Vector (Human) (CMV)
30785101 1 µg

MT-ND4L AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Pig NGB / Neuroglobin Recombinant Protein
R0606p 1 Each

Pig NGB / Neuroglobin Recombinant Protein

Sign In for Pricing
View Details
Signal Peptide Peptidase Polyclonal Antibody, PerCP Conjugated
bs-11178R-PerCP 100 µL

Signal Peptide Peptidase Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Kinesin-Like Protein KIF2C (KIF2C) Antibody
abx456908-01 50 µg

Kinesin-Like Protein KIF2C (KIF2C) Antibody

Sign In for Pricing
View Details
Kinesin-Like Protein KIF2C (KIF2C) Antibody
abx456908-02 100 µg

Kinesin-Like Protein KIF2C (KIF2C) Antibody

Sign In for Pricing
View Details