Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse anti Integrin alpha 3A

Product Specifications

Background

Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.

CAS Number

9007-83-4

UniProt

P26006

Host

Mouse

Species Reactivity

Human

Isotype

IgG1

Clone

29A3

Type

Primary Antibodies

Source

29A3 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Applications

ICC, IHC (frozen), WB

Field of Research

Cancer, Cell adhesion

Assay Principle

29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:100 – 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 – 1:1000 for immunoblotting applications.

Form

Each vial contains 100 µL 1 mg/mL purified monoclonal antibody in PBS containing 0,09% sodium azide

Precautions

This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving Humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.

References & Citations

1. Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. _x000D_ 2. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.

Storage Conditions

The antibody is shipped at ambient temperature and may be stored at +4°C; For prolonged storage prepare appropriate aliquots and store at or below -20°C; Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2); Repeated thawing and freezing should be avoided; Working dilutions should be stored at +4°C, not refrozen, and preferably used the same day; If a slight precipitation occurs upon storage, this should be removed by centrifugation; It will not affect the performance or the concentration of the product

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRP Polyclonal Antibody
RD90747A-01 50 µL

CRP Polyclonal Antibody

Sign In for Pricing
View Details
CRP Polyclonal Antibody
RD90747A-02 100 µL

CRP Polyclonal Antibody

Sign In for Pricing
View Details
Human Small Intestine RNA
1H24-250 250 µg

Human Small Intestine RNA

Sign In for Pricing
View Details
CD19 Antibody (FITC)
orb1250771 100 Tests

CD19 Antibody (FITC)

Sign In for Pricing
View Details
INF2 Protein Vector (Mouse) (pPM-C-His)
PV191769 500 ng

INF2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CYTL1 Polyclonal Antibody
E20-71256 100 µg

CYTL1 Polyclonal Antibody

Sign In for Pricing
View Details