Animal-Free GRO-alpha/CXCL1, Mouse
GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC (5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. Animal-Free GRO-alpha/CXCL1 Protein, Mouse is the recombinant mouse-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with tag free. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free GRO-alpha/CXCL1 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-gro-alpha-kc-5-72-protein-mouse-his.html
Purity
95.0
Smiles
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Molecular Formula
14825 (Gene_ID) P12850 (N29-K96) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF647 conjugate, 0.1mg/mL
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF488A conjugate, 0.1mg/mL
