Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Puccinia triticina Secreted protein (PTTG_11654)

Product Specifications

Abbreviation

Recombinant Puccinia triticina PTTG_11654 protein

Gene Name

PTTG_11654

UniProt

A0A180GYK0

Expression Region

19-177aa

Organism

Puccinia triticina (isolate 1-1 / race 1 (BBBD) ) (Brown leaf rust fungus)

Target Sequence

DSAQSNASMSASQPKVSPMQCGNIFLPLSPVDIAEMQSKGGLSASERAKLSKDPVEAVCKSTATGTDGGICDFKSCSGKPAVCGTCYPVTMKEGKLVKTSETSVASVECGKNYFLKTEKDHNICTAYDNKMYSCTGECKASIECQSCVRMDDPAFKQAA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.2 kDa

References & Citations

"Comparative analysis highlights variable genome content of wheat rusts and divergence of the mating loci." Cuomo C.A., Bakkeren G., Szabo L., Khalil H., Joly D., Goldberg J., Young S., Zeng Q., Fellers J. Submitted (MAY-2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100 Calcium Binding Protein A10 (Recombinant)
22060474-1 2 µg

Human S100 Calcium Binding Protein A10 (Recombinant)

Sign In for Pricing
View Details
Recombinant MAOA protein
MBS388212-01 0.01 mg

Recombinant MAOA protein

Sign In for Pricing
View Details
Recombinant MAOA protein
MBS388212-02 5x 0.01 mg

Recombinant MAOA protein

Sign In for Pricing
View Details
RPS6KC1 Blocking Peptide
abx061156-01 1 mg

RPS6KC1 Blocking Peptide

Sign In for Pricing
View Details
RPS6KC1 Blocking Peptide
abx061156-02 5 mg

RPS6KC1 Blocking Peptide

Sign In for Pricing
View Details
Butylphthalide Impurity 72
RM-B212572-01 10 mg

Butylphthalide Impurity 72

Sign In for Pricing
View Details