Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fin bud initiation factor (fibin)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Zebrafish fibin protein

Gene Name

Fibin

UniProt

A1IGX5

Expression Region

24-210aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Essential for the initiation of pectoral fin bud formation. Potentially acts downstream of retinoic acid and Wnt signaling and is required for tbx5 expression in the lateral plate mesoderm of presumptive pectoral fin bud regions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.9 kDa

References & Citations

"Fibin, a novel secreted lateral plate mesoderm signal, is essential for pectoral fin bud initiation in zebrafish." Wakahara T., Kusu N., Yamauchi H., Kimura I., Konishi M., Miyake A., Itoh N. Dev. Biol. 303:527-535 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARL2BP Antibody [DyLight 350]
NBP3-00281UV 0.1 mL

Rabbit Polyclonal ARL2BP Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse Monoclonal MRG15 Antibody (OTI5D2) [Alexa Fluor 647]
NBP2-72778AF647 0.1 mL

Mouse Monoclonal MRG15 Antibody (OTI5D2) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Midkine Alexa Fluor 647 MAb (Clone 2284A)
IC2581R-100UG 100 µg

Human Midkine Alexa Fluor 647 MAb (Clone 2284A)

Sign In for Pricing
View Details
PRRC2CP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV741741 1.0 µg DNA

PRRC2CP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Olr546 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV634703 1.0 µg DNA

Olr546 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GPD1 Recombinant Protein (Rat)
RP203216 100 µg

GPD1 Recombinant Protein (Rat)

Sign In for Pricing
View Details