Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD294/PTGDR2 Antibody
MBS1569778-01 0.05 mg

Anti-Human CD294/PTGDR2 Antibody

Sign In for Pricing
View Details
Anti-Human CD294/PTGDR2 Antibody
MBS1569778-02 0.1 mg

Anti-Human CD294/PTGDR2 Antibody

Sign In for Pricing
View Details
Anti-Human CD294/PTGDR2 Antibody
MBS1569778-03 5x 0.1 mg

Anti-Human CD294/PTGDR2 Antibody

Sign In for Pricing
View Details
Olfr267 (NM_146920) Mouse Tagged Lenti ORF Clone
MR213363L4 10 µg

Olfr267 (NM_146920) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CBX8, CT (Chromobox Protein Homolog 8, Polycomb 3 Homolog, Pc3, HPC3, Rectachrome 1, PC3, RC1) (MaxLight 550) discontinued
C2098-89B-ML550 100 µL

CBX8, CT (Chromobox Protein Homolog 8, Polycomb 3 Homolog, Pc3, HPC3, Rectachrome 1, PC3, RC1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ITGB1BP3 Antibody
GWB-MP244A 50 µg

ITGB1BP3 Antibody

Sign In for Pricing
View Details