Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODF1 Antibody, HRP conjugated
A54217-50UG 50 µg

ODF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
alpha 5 Defensin (DEFA5) (NM_021010) Human Tagged Lenti ORF Clone
RC210219L3 10 µg

alpha 5 Defensin (DEFA5) (NM_021010) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pkd2l1 Rat shRNA Plasmid (Locus ID 293937)
TL704935 1 Kit

Pkd2l1 Rat shRNA Plasmid (Locus ID 293937)

Sign In for Pricing
View Details
ELISA kit for Rat CHD5 (Chromodomain Helicase DNA Binding Protein 5)
E-EL-R0205 96 Tests

ELISA kit for Rat CHD5 (Chromodomain Helicase DNA Binding Protein 5)

Sign In for Pricing
View Details
Hirudin (desulfated) Peptide
abx266688-01 1 mg

Hirudin (desulfated) Peptide

Sign In for Pricing
View Details
Hirudin (desulfated) Peptide
abx266688-02 5 mg

Hirudin (desulfated) Peptide

Sign In for Pricing
View Details