Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCK5 Human qPCR Primer Pair (NM_174922)
HP218566 200 Reactions

ADCK5 Human qPCR Primer Pair (NM_174922)

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA501373AM 100 µL

elF2 alpha (EIF2S1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]

Sign In for Pricing
View Details
BMP2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV656892 1.0 µg DNA

BMP2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Human KISS-1 Metastasis-Suppressor
7-05442 1 mg

Recombinant Human KISS-1 Metastasis-Suppressor

Sign In for Pricing
View Details
Human Basic Salivary Proline Rich Protein 3 (PRB3) ELISA kit
RDR-PRB3-Hu-48Tests 48 Tests

Human Basic Salivary Proline Rich Protein 3 (PRB3) ELISA kit

Sign In for Pricing
View Details
Rat Monoclonal IgD Antibody (11-26C) [CoraFluor 1]
FAB9858CL1 0.1 mL

Rat Monoclonal IgD Antibody (11-26C) [CoraFluor 1]

Sign In for Pricing
View Details