Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufaf6 Mouse shRNA Lentiviral Particle (Locus ID 76947)
TL518266V 500 µL Each

Ndufaf6 Mouse shRNA Lentiviral Particle (Locus ID 76947)

Sign In for Pricing
View Details
Albumin BioAssayTM Kit (With Standard, Methyl Bromide Green Method) discontinued
405741 1 Kit

Albumin BioAssayTM Kit (With Standard, Methyl Bromide Green Method) discontinued

Sign In for Pricing
View Details
Rabbit Anti-CAC1A/CACNA1A Polyclonal Antibody
PAV631 100 μL

Rabbit Anti-CAC1A/CACNA1A Polyclonal Antibody

Sign In for Pricing
View Details
Cdkn2b ORF Vector (Mouse) (pORF)
ORF041069 1.0 µg DNA

Cdkn2b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Probable phosphatase SO_1652 (SO_1652)
MBS1437646-01 0.02 mg (E-Coli)

Recombinant Shewanella oneidensis Probable phosphatase SO_1652 (SO_1652)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Probable phosphatase SO_1652 (SO_1652)
MBS1437646-02 0.1 mg (E-Coli)

Recombinant Shewanella oneidensis Probable phosphatase SO_1652 (SO_1652)

Sign In for Pricing
View Details