Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Glucans biosynthesis glucosyltransferase H (mdoH), partial
MBS1227805-01 1 mg (E-Coli)

Recombinant Shigella flexneri Glucans biosynthesis glucosyltransferase H (mdoH), partial

Sign In for Pricing
View Details
Recombinant Shigella flexneri Glucans biosynthesis glucosyltransferase H (mdoH), partial
MBS1227805-02 1 mg (Yeast)

Recombinant Shigella flexneri Glucans biosynthesis glucosyltransferase H (mdoH), partial

Sign In for Pricing
View Details
IgE (FITC) discontinued
I1900-02M-FITC 100 µL

IgE (FITC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal KIST Antibody (OTI2H4) [mFluor Violet 450 SE]
NBP2-72383MFV450 0.1 mL

Mouse Monoclonal KIST Antibody (OTI2H4) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Lentiviral mouse Mark4 shRNA (UAS) - Lentiviral mouse Mark4 shRNA (UAS, GFP) (100)
GTR15213453 1 Vial

Lentiviral mouse Mark4 shRNA (UAS) - Lentiviral mouse Mark4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
AKT3 Polyclonal Antibody
MBS9132695-01 0.02 mL

AKT3 Polyclonal Antibody

Sign In for Pricing
View Details