Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADD Antibody
A62291-100UL 100 µL

FADD Antibody

Sign In for Pricing
View Details
ERH Antibody
A39238-100UG 100 µg

ERH Antibody

Sign In for Pricing
View Details
Cyclohexanol 99.5% AR
00911 02500 2.5 L

Cyclohexanol 99.5% AR

Sign In for Pricing
View Details
Lentiviral mouse Nsun6 shRNA (UAS) - Lentiviral mouse Nsun6 shRNA (UAS, iRFP) (25)
GTR15189434 1 Vial

Lentiviral mouse Nsun6 shRNA (UAS) - Lentiviral mouse Nsun6 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Hepatitis B Virus (HBV, Hepatitis B, Hep B) (FITC)
226981-FITC 100 µL

Hepatitis B Virus (HBV, Hepatitis B, Hep B) (FITC)

Sign In for Pricing
View Details
Mouse Lysophospholipid acyltransferase 2, Mboat2 ELISA KIT
ELI-43051m 96 Tests

Mouse Lysophospholipid acyltransferase 2, Mboat2 ELISA KIT

Sign In for Pricing
View Details