Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GORAB polyclonal antibody
BZ16204-01 50 µL

GORAB polyclonal antibody

Sign In for Pricing
View Details
GORAB polyclonal antibody
BZ16204-02 100 µL

GORAB polyclonal antibody

Sign In for Pricing
View Details
Anti-EphB2 antibody
STJ98032 100 µl

Anti-EphB2 antibody

Sign In for Pricing
View Details
Vmn1r228 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3321806 1.0 µg DNA

Vmn1r228 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Morn1 (NM_001081100) Mouse Tagged ORF Clone
MR221323 10 µg

Morn1 (NM_001081100) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KCNF1 CytoSection
TS406124P5 25 Slides

KCNF1 CytoSection

Sign In for Pricing
View Details