Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit
RD-VEGF165-Hu-48Tests 48 Tests

Human Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human ILDR1 sgRNA gene knockout kit - Lentiviral human ILDR1 sgRNA gene knockout kit (100)
GTR15380260 1 Vial

Lentiviral human ILDR1 sgRNA gene knockout kit - Lentiviral human ILDR1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB622640 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
MYOZ2 (Myozenin-2, CS-1, CMH16, C4orf5) (MaxLight 650)
MBS6447853-01 0.1 mL

MYOZ2 (Myozenin-2, CS-1, CMH16, C4orf5) (MaxLight 650)

Sign In for Pricing
View Details
MYOZ2 (Myozenin-2, CS-1, CMH16, C4orf5) (MaxLight 650)
MBS6447853-02 5x 0.1 mL

MYOZ2 (Myozenin-2, CS-1, CMH16, C4orf5) (MaxLight 650)

Sign In for Pricing
View Details
Human CENPW shRNA Plasmid
abx967725-01 150 µg

Human CENPW shRNA Plasmid

Sign In for Pricing
View Details