Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OBFC2A Antibody [Alexa Fluor 594]
NBP1-26640AF594 0.1 mL

Rabbit Polyclonal OBFC2A Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
MSF (SEPT9) (NM_006640) Human 3' UTR Clone
SC217184 10 µg

MSF (SEPT9) (NM_006640) Human 3' UTR Clone

Sign In for Pricing
View Details
CLEC2L Rabbit Polyclonal Antibody (N-term)
E28PB0848 100 µL

CLEC2L Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
LRP5, CT (LRP5, LR3, LRP7, Low-density lipoprotein receptor-related protein 5) (MaxLight 750)
MBS6316975-01 0.1 mL

LRP5, CT (LRP5, LR3, LRP7, Low-density lipoprotein receptor-related protein 5) (MaxLight 750)

Sign In for Pricing
View Details
LRP5, CT (LRP5, LR3, LRP7, Low-density lipoprotein receptor-related protein 5) (MaxLight 750)
MBS6316975-02 5x 0.1 mL

LRP5, CT (LRP5, LR3, LRP7, Low-density lipoprotein receptor-related protein 5) (MaxLight 750)

Sign In for Pricing
View Details
Anti-ZNF408 IP (SAA0241) (Mouse, Monoclonal, IgG2a)
A132979 100 µL

Anti-ZNF408 IP (SAA0241) (Mouse, Monoclonal, IgG2a)

Sign In for Pricing
View Details