Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX12 AAV Vector (Human) (CMV)
45135101 1 µg

SOX12 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
p2CT-His-MBP-Lbu-C2c2-R472A-H477A-R1048A-H1053A Plasmid
PVT10652 2 µg

p2CT-His-MBP-Lbu-C2c2-R472A-H477A-R1048A-H1053A Plasmid

Sign In for Pricing
View Details
Human Chd3 (Chromodomain Helicase DNA Binding Protein 3) ELISA Kit
FY-EH4853 96 Well

Human Chd3 (Chromodomain Helicase DNA Binding Protein 3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 10 Antibody (VIK-10) [DyLight 680]
NB500-354FR 0.1 mL

Mouse Monoclonal Cytokeratin 10 Antibody (VIK-10) [DyLight 680]

Sign In for Pricing
View Details
Lentiviral mouse Pappa2 shRNA (UAS) - Lentiviral mouse Pappa2 shRNA (UAS, iRFP) (100)
GTR15285519 1 Vial

Lentiviral mouse Pappa2 shRNA (UAS) - Lentiviral mouse Pappa2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
4-(Butylamino)benzoic Acid
TRC-B689445-5G 5 g

4-(Butylamino)benzoic Acid

Sign In for Pricing
View Details