Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNB2, phosphorylated (S392) (Ccnb2, Cycb2, G2/mitotic-specific cyclin-B2) (MaxLight 650) discontinued
033385-ML650 100 µL

CCNB2, phosphorylated (S392) (Ccnb2, Cycb2, G2/mitotic-specific cyclin-B2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GSTZ1 Protein, Human, Recombinant (His Tag)
PH50534E1 100 µg

GSTZ1 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
ATP synthase, H+ transporting, Mitochondrial F1 complex, delta subunit
307185 100 µL

ATP synthase, H+ transporting, Mitochondrial F1 complex, delta subunit

Sign In for Pricing
View Details
TNNI2 Protein Lysate (Rat) with C-HA Tag
47247036 100 µg

TNNI2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
EphA4 Protein (C-His, Mouse)
P524307 100 µg

EphA4 Protein (C-His, Mouse)

Sign In for Pricing
View Details
N'- ((Dimethylamino) methylene) -N, N-dimethylformohydrazonamide dihydrochloride
OR1038975-01 5 g

N'- ((Dimethylamino) methylene) -N, N-dimethylformohydrazonamide dihydrochloride

Sign In for Pricing
View Details