Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit
MBS2804105-01 48 Tests

Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit

Sign In for Pricing
View Details
Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit
MBS2804105-02 96 Tests

Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit

Sign In for Pricing
View Details
Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit
MBS2804105-03 5x 96 Tests

Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit

Sign In for Pricing
View Details
Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit
MBS2804105-04 10x 96 Tests

Human Two pore calcium channel protein 2 (TPCN2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human AATK sgRNA gene knockout kit - Lentiviral human AATK sgRNA gene knockout kit (100)
GTR15373627 1 Vial

Lentiviral human AATK sgRNA gene knockout kit - Lentiviral human AATK sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (MaxLight 550)
MBS6212602-01 0.1 mL

MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (MaxLight 550)

Sign In for Pricing
View Details