Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Complement Factor H Antibody (10-10) [DyLight 680]
NBP2-52743FR 0.1 mL

Mouse Monoclonal Complement Factor H Antibody (10-10) [DyLight 680]

Sign In for Pricing
View Details
Rabbi! anti-C18orf25 Antibody, Affinity Purified
A303-394A 100 µg

Rabbi! anti-C18orf25 Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Human CHRM3 Protein, N-His-KSI
E55P7796 50 µg

Recombinant Human CHRM3 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Human ZNF319 Protein
E30P12153 20 µg

Recombinant Human ZNF319 Protein

Sign In for Pricing
View Details
Anti-Human IFNG/IFN-gamma Antibody (SAA0414), FITC
HF813117-01 1 Each

Anti-Human IFNG/IFN-gamma Antibody (SAA0414), FITC

Sign In for Pricing
View Details
Anti-Human IFNG/IFN-gamma Antibody (SAA0414), FITC
HF813117-02 100 Tests

Anti-Human IFNG/IFN-gamma Antibody (SAA0414), FITC

Sign In for Pricing
View Details