Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYG2 / LYGH (20-212, His-tag) Human Protein
AR50573PU-S 50 µg

LYG2 / LYGH (20-212, His-tag) Human Protein

Sign In for Pricing
View Details
Prl8a5 Protein Vector (Rat) (pPM-C-HA)
37703026 500 ng

Prl8a5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rat LRRC18 shRNA Plasmid
abx989377-01 150 µg

Rat LRRC18 shRNA Plasmid

Sign In for Pricing
View Details
Rat LRRC18 shRNA Plasmid
abx989377-02 300 µg

Rat LRRC18 shRNA Plasmid

Sign In for Pricing
View Details
PRM2 Protein Vector (Rat) (pPB-N-His)
PV296275 500 ng

PRM2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (APC)
MBS6261021-01 0.1 mL

HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (APC)

Sign In for Pricing
View Details