Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIS11B (ZFP36L1) (NM_004926) Human Untagged Clone
SC117032 10 µg

TIS11B (ZFP36L1) (NM_004926) Human Untagged Clone

Sign In for Pricing
View Details
Slc4a10 (NM_001242379) Mouse Untagged Clone
MC229374 10 µg

Slc4a10 (NM_001242379) Mouse Untagged Clone

Sign In for Pricing
View Details
Pmepa1 (NM_022995) Mouse Tagged ORF Clone Lentiviral Particle
MR217531L3V 200 µL

Pmepa1 (NM_022995) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) PDXA Polyclonal Antibody
MBS7169586 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) PDXA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Sheep CD59 glycoprotein (CD59)
MBS949337-01 0.05 mg (E-Coli)

Recombinant Sheep CD59 glycoprotein (CD59)

Sign In for Pricing
View Details
Recombinant Sheep CD59 glycoprotein (CD59)
MBS949337-02 0.2 mg (E-Coli)

Recombinant Sheep CD59 glycoprotein (CD59)

Sign In for Pricing
View Details