Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE1, SLOX1) (MaxLight 405) discontinued
L3514-54C-ML405 100 µL

LOX1 (LOX-1, hLOX-1, C-type Lectin Domain Family 8 Member A, CLEC8A, Lectin-like Oxidized LDL Receptor 1, Lectin-like oxLDL Receptor 1, Lectin-type Oxidized LDL Receptor 1, LOXIN, Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, OLR1, SCARE1, SLOX1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Infectious Bursal Disease Virus (IBDV, VP3) (HRP) discontinued
171601-HRP 100 µL

Infectious Bursal Disease Virus (IBDV, VP3) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type T, PTPRT/LAR GENLISA ELISA
KLM1273 96 Well

Mouse Protein Tyrosine Phosphatase Receptor Type T, PTPRT/LAR GENLISA ELISA

Sign In for Pricing
View Details
ANAPC11 Rabbit pAb
A15449-01 20 µL

ANAPC11 Rabbit pAb

Sign In for Pricing
View Details
ANAPC11 Rabbit pAb
A15449-02 100 μL

ANAPC11 Rabbit pAb

Sign In for Pricing
View Details
ANAPC11 Rabbit pAb
A15449-03 500 μL

ANAPC11 Rabbit pAb

Sign In for Pricing
View Details