Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Hedgehog Interacting Protein (HHIP) ELISA Kit
RDR-HHIP-Hu-96Tests 96 Tests

Human Hedgehog Interacting Protein (HHIP) ELISA Kit

Sign In for Pricing
View Details
CD9 Monoclonal Antibody
TA399533 100 µg

CD9 Monoclonal Antibody

Sign In for Pricing
View Details
BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (Azide free) (HRP)
MBS6279092-01 0.2 mL

BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (Azide free) (HRP)

Sign In for Pricing
View Details
BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (Azide free) (HRP)
MBS6279092-02 5x 0.2 mL

BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (Azide free) (HRP)

Sign In for Pricing
View Details
Biotin-2-sulfopropanoic acid TEA
MF-0150432-01 100 mg

Biotin-2-sulfopropanoic acid TEA

Sign In for Pricing
View Details
Biotin-2-sulfopropanoic acid TEA
MF-0150432-02 250 mg

Biotin-2-sulfopropanoic acid TEA

Sign In for Pricing
View Details