Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM55B sgRNA CRISPR Lentivector (Human) (Target 3)
K2391204 1.0 µg DNA

TMEM55B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ptdss2 AAV siRNA Pooled Vector
38071166 1.0 µg

Ptdss2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MEF2AP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1288107 1.0 µg DNA

MEF2AP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Contactin 5 / CNTN5 ELISA Kit
NS-E10052-01 1 Each

Human Contactin 5 / CNTN5 ELISA Kit

Sign In for Pricing
View Details
Human Contactin 5 / CNTN5 ELISA Kit
NS-E10052-02 1 Each

Human Contactin 5 / CNTN5 ELISA Kit

Sign In for Pricing
View Details
SNAP23 Recombinant Protein (Mouse)
RP174131 100 µg

SNAP23 Recombinant Protein (Mouse)

Sign In for Pricing
View Details