Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR1322 Human qPCR Primer Pair (MI0006653)
HP300141 200 Reactions

MIR1322 Human qPCR Primer Pair (MI0006653)

Sign In for Pricing
View Details
Lentiviral human DNAJC27 shRNA (UAS) - Lentiviral human DNAJC27 shRNA (UAS, RFP) (25)
GTR15098975 1 Vial

Lentiviral human DNAJC27 shRNA (UAS) - Lentiviral human DNAJC27 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Kcnh8 sgRNA CRISPR Lentivector set (Mouse)
K3203601 3x 1.0 µg

Kcnh8 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SH3GL3 Protein Vector (Mouse) (pPM-C-His)
PV228873 500 ng

SH3GL3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Gm648 3'UTR Luciferase Stable Cell Line
TU108422 1.0 mL

Gm648 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
10x RNA Glycerol Gel Loading Buffer
LB8-1mL 1 mL

10x RNA Glycerol Gel Loading Buffer

Sign In for Pricing
View Details