Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYRM5 (ETFRF1) (NM_001001660) Human Tagged ORF Clone Lentiviral Particle
RC210695L4V 200 µL

LYRM5 (ETFRF1) (NM_001001660) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GTDC1 rabbit pAb
UB-GEN-11988 100 µL

GTDC1 rabbit pAb

Sign In for Pricing
View Details
1700061G19Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4796207 1.0 µg DNA

1700061G19Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (231)
NBP2-43570 0.1 mL

Mouse Monoclonal DYKDDDDK Epitope Tag Antibody (231)

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Polyclonal Antibody, Cy3 Conjugated
bs-8813R-Cy3 100 µL

Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1)
MBS2051627-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1)

Sign In for Pricing
View Details