Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal P2X7/P2RX7 Antibody (545205) [DyLight 405]
MAB97901V 0.1 mL

Mouse Monoclonal P2X7/P2RX7 Antibody (545205) [DyLight 405]

Sign In for Pricing
View Details
PHYHD1 (NM_001100876) Human Tagged ORF Clone Lentiviral Particle
RC222781L4V 200 µL

PHYHD1 (NM_001100876) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Molybdenum Disilicide (MoSi2) Micron Powder
NMP-1095 1 Kg

Molybdenum Disilicide (MoSi2) Micron Powder

Sign In for Pricing
View Details
APOF Antibody
MBS9509186-01 0.05 mL

APOF Antibody

Sign In for Pricing
View Details
APOF Antibody
MBS9509186-02 0.1 mL

APOF Antibody

Sign In for Pricing
View Details
APOF Antibody
MBS9509186-03 5x 0.1 mL

APOF Antibody

Sign In for Pricing
View Details