Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1S1 Antibody
E30AC3438 100 µL

AKT1S1 Antibody

Sign In for Pricing
View Details
UBC9 (C-12) Alexa Fluor® 488
sc-271057 AF488 200 µg/mL

UBC9 (C-12) Alexa Fluor® 488

Sign In for Pricing
View Details
Α- (1 (6) -fucosyltransferase (FUT8) Rat ELISA Kit
B3909 96 Tests

Α- (1 (6) -fucosyltransferase (FUT8) Rat ELISA Kit

Sign In for Pricing
View Details
Mouse Tek Pre-designed siRNA Set B
SI114427B 1 Each

Mouse Tek Pre-designed siRNA Set B

Sign In for Pricing
View Details
NSD3 (WHSC1L1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
TA810070AM 100 µL

NSD3 (WHSC1L1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

Sign In for Pricing
View Details
Canine Rho guanine nucleotide exchange factor 10-like protein ELISA Kit
MBS7274677-01 48 Well

Canine Rho guanine nucleotide exchange factor 10-like protein ELISA Kit

Sign In for Pricing
View Details