Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Synuclein (SNCA) Antibody (APC)
abx442806 100 µg

Alpha Synuclein (SNCA) Antibody (APC)

Sign In for Pricing
View Details
HVD3 (25-Hydroxyvitamin D3) ELISA Kit
EK247318 96 Well

HVD3 (25-Hydroxyvitamin D3) ELISA Kit

Sign In for Pricing
View Details
DNMT3L Human Gene Knockout Kit (CRISPR)
KN400187 1 Kit

DNMT3L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human pre-microRNA Expression Construct Lenti-miR-374a
PMIRH374aPA-1 Bacterial Streak

Human pre-microRNA Expression Construct Lenti-miR-374a

Sign In for Pricing
View Details
FGFR3 (NM_000142) Human Tagged Lenti ORF Clone
RC215533L3 10 µg

FGFR3 (NM_000142) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Thrombin/Antithrombin Complex (TAT)
MBS2149153-01 0.1 mL

PE-Linked Monoclonal Antibody to Thrombin/Antithrombin Complex (TAT)

Sign In for Pricing
View Details