Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-IL15RA-1-3×FLAG-SV40-Neo Plasmid
PVT45440 2 µg

pCMV-IL15RA-1-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
Mouse HAI-1 Matched Antibody Pair Set (RC86/RD16)
Z01LS-1022-LS394 5 Plates

Mouse HAI-1 Matched Antibody Pair Set (RC86/RD16)

Sign In for Pricing
View Details
GPAA1, NT (GPAA1, GAA1, Glycosylphosphatidylinositol anchor attachment 1 protein, GAA1 protein homolog) (MaxLight 405) discontinued
036186-ML405 100 µL

GPAA1, NT (GPAA1, GAA1, Glycosylphosphatidylinositol anchor attachment 1 protein, GAA1 protein homolog) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal UCH-L5/UCH37 Antibody
NBP1-85656 0.1 mL

Rabbit Polyclonal UCH-L5/UCH37 Antibody

Sign In for Pricing
View Details
Indeno[1,2,3-cd]pyrene
MBS6067022-01 10 mg

Indeno[1,2,3-cd]pyrene

Sign In for Pricing
View Details
Indeno[1,2,3-cd]pyrene
MBS6067022-02 100 mg

Indeno[1,2,3-cd]pyrene

Sign In for Pricing
View Details