Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DAP10/HCST Antibody (982107) [Alexa Fluor 488]
MAB97862AF488 0.1 mL

Mouse Monoclonal DAP10/HCST Antibody (982107) [Alexa Fluor 488]

Sign In for Pricing
View Details
Theileria annulata One-Step PCR kit
Oneq-V299-100D 100T

Theileria annulata One-Step PCR kit

Sign In for Pricing
View Details
Rat IgD (Immunoglobulin D) ELISA Kit
ELK7625-01 48 Tests

Rat IgD (Immunoglobulin D) ELISA Kit

Sign In for Pricing
View Details
Rat IgD (Immunoglobulin D) ELISA Kit
ELK7625-02 96 Tests

Rat IgD (Immunoglobulin D) ELISA Kit

Sign In for Pricing
View Details
Complement Factor H (CFH) Antibody Pair
abx370004-01 5x 96 Tests

Complement Factor H (CFH) Antibody Pair

Sign In for Pricing
View Details
Complement Factor H (CFH) Antibody Pair
abx370004-02 10x 96 Tests

Complement Factor H (CFH) Antibody Pair

Sign In for Pricing
View Details