Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lgals7 shRNA (UAS) - Lentiviral mouse Lgals7 shRNA (UAS, iRFP) (100)
GTR15188079 1 Vial

Lentiviral mouse Lgals7 shRNA (UAS) - Lentiviral mouse Lgals7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Developing Solution
G2023-250ML 250 mL

Developing Solution

Sign In for Pricing
View Details
pExpress-1-Hmgb2 Plasmid
PVT38711 2 µg

pExpress-1-Hmgb2 Plasmid

Sign In for Pricing
View Details
Recombinant Human SCAPER Protein - (Dry Ice)
H00049855-P01-10ug 10 µg

Recombinant Human SCAPER Protein - (Dry Ice)

Sign In for Pricing
View Details
ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (AP) discontinued
135712-AP 100 µL

ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1) (AP) discontinued

Sign In for Pricing
View Details
NMS (NM_001012233) Rat Tagged Lenti ORF Clone
RR214132L4 10 µg

NMS (NM_001012233) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details