Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD1, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMIGD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd1-protein-human-hek293-his.html

Purity

95.60

Smiles

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Molecular Formula

388364 (Gene_ID) Q6UXZ0-1/NP_996663.1 (V30-P220) (Accession)

Molecular Weight

Approximately 37-55 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protocadherin beta-15 (PCDHB15) ELISA Kit
MBS9714962-01 48 Tests

Human Protocadherin beta-15 (PCDHB15) ELISA Kit

Sign In for Pricing
View Details
Human Protocadherin beta-15 (PCDHB15) ELISA Kit
MBS9714962-02 96 Tests

Human Protocadherin beta-15 (PCDHB15) ELISA Kit

Sign In for Pricing
View Details
Human Protocadherin beta-15 (PCDHB15) ELISA Kit
MBS9714962-03 5x 96 Tests

Human Protocadherin beta-15 (PCDHB15) ELISA Kit

Sign In for Pricing
View Details
UBE2C Protein Vector (Rat) (pPM-C-HA)
48949026 500 ng

UBE2C Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal DLGAP2 Antibody
NBP3-05104-100ul 100 µL

Rabbit Polyclonal DLGAP2 Antibody

Sign In for Pricing
View Details
RBPMS Mouse Monoclonal Antibody [Clone ID: LBI4H6]
AMM14452VCF 100 µg

RBPMS Mouse Monoclonal Antibody [Clone ID: LBI4H6]

Sign In for Pricing
View Details