Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (GST)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (GST) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (GST), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-gst.html

Purity

98.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 76 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Badge

Hot

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX23 3'UTR Lenti-reporter-Luc Vector
17821081 1.0 µg

DDX23 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human SEMA3F qPCR Primer Pair
QH22421S 200 Tests

Human SEMA3F qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-KCHIP1 Antibody
DL99115A-01 50 µL

Rabbit anti-KCHIP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-KCHIP1 Antibody
DL99115A-02 100 µL

Rabbit anti-KCHIP1 Antibody

Sign In for Pricing
View Details
EGFL8 (Epidermal Growth Factor-like Protein 8, EGF-like Protein 8, Vascular Endothelial Statin-2, VE-statin-2, C6orf8, NG3, UNQ8752/PRO29920)
137930 100 µg

EGFL8 (Epidermal Growth Factor-like Protein 8, EGF-like Protein 8, Vascular Endothelial Statin-2, VE-statin-2, C6orf8, NG3, UNQ8752/PRO29920)

Sign In for Pricing
View Details
Disintegrin And Metalloproteinase Domain-Containing Protein 9 (ADAM9) Antibody
abx461572-01 100 µg

Disintegrin And Metalloproteinase Domain-Containing Protein 9 (ADAM9) Antibody

Sign In for Pricing
View Details