Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitronectin (VTN) (Active)

Product Specifications

Product Name Alternative

Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN

Abbreviation

Recombinant Human VTN protein (Active)

Gene Name

VTN

UniProt

P04004

Expression Region

20-478aa

Organism

Homo sapiens (Human)

Target Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤1 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ITGAV/Integrin alpha-V ELISA Kit
E1346Hu 96 Tests

Human ITGAV/Integrin alpha-V ELISA Kit

Sign In for Pricing
View Details
Cal-590™ AM
20512-AAT 1 mg

Cal-590™ AM

Sign In for Pricing
View Details
Monoclonal Anti-Human IgG Antibody FA-Labeled (for TR-FRET)
FRT-TA02-5000tests 5000 Tests

Monoclonal Anti-Human IgG Antibody FA-Labeled (for TR-FRET)

Sign In for Pricing
View Details
Recombinant Taenia solium Triosephosphate isomerase
MBS1310826-01 0.02 mg (E-Coli)

Recombinant Taenia solium Triosephosphate isomerase

Sign In for Pricing
View Details
Recombinant Taenia solium Triosephosphate isomerase
MBS1310826-02 0.1 mg (E-Coli)

Recombinant Taenia solium Triosephosphate isomerase

Sign In for Pricing
View Details
Recombinant Taenia solium Triosephosphate isomerase
MBS1310826-03 0.02 mg (Yeast)

Recombinant Taenia solium Triosephosphate isomerase

Sign In for Pricing
View Details