Cardiotrophin-1/CTF1, Mouse (HEK293)
Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.
Product Specifications
Product Name Alternative
Cardiotrophin-1/CTF1 Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ct-1-protein-mouse-hek293-his.html
Purity
95.0
Smiles
SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
Molecular Formula
13019 (Gene_ID) Q60753 (S2-A203) (Accession)
Molecular Weight
22-27 kDa
References & Citations
[1]López-Yoldi M, et al. Cardiotrophin-1: A multifaceted cytokine. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :523-32.|[2]Peng L, et al. Cardiotrophin-1 stimulates the neural differentiation of human umbilical cord blood-derived mesenchymal stem cells and survival of differentiated cells through PI3K/Akt-dependent signaling pathways. Cytotechnology. 2017 Dec;69 (6) :933-941.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal ATP7b Antibody [PE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
K6145105 3x 1.0 µg
Pid1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details