CD59, Human (P.pastoris, His)
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (P.pastoris, His) is the recombinant human-derived CD59 protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
CD59 Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd59-protein-human-p-pastoris-his.html
Smiles
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Molecular Formula
966 (Gene_ID) P13987-1 (L26-N102) (Accession)
Molecular Weight
Approximately 11.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD72 (B Cell Marker) (BU40), CF647 conjugate, 0.1mg/mL
Factor H (CFH) (577-588) Goat Polyclonal Antibody
Cortactin (CTTN) (NM_138565) Human Recombinant Protein
