Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (P.pastoris, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (P.pastoris, His) is the recombinant human-derived CD59 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-p-pastoris-his.html

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-16 Antibody Pair Set
E-KAB-0578 50 µL & 100 µg

Mouse IL-16 Antibody Pair Set

Sign In for Pricing
View Details
3-(Oxan-4-yl)pentanedioic Acid
TRC-O845280-10MG 10 mg

3-(Oxan-4-yl)pentanedioic Acid

Sign In for Pricing
View Details
9-Decyn-1-ol (94%)
TRC-D352100-250MG 250 mg

9-Decyn-1-ol (94%)

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-15981-01 20 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-15981-02 60 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-15981-03 120 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details