Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Human (HEK293, His)

ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF) . ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS) [1].

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-human-hek293-his.html

Purity

95.0

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMHHHHHH

Molecular Formula

79827 (Gene_ID) Q9H6B4 (T19-M233) (Accession)

Molecular Weight

Approximately 35.0 kDa

References & Citations

[1]Elena Ortiz-Zapater, et al. CAR: A key regulator of adhesion and inflammation. Int J Biochem Cell Biol. 2017 Aug;89:1-5.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details