Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASAM/CLMP, Human (HEK293, His)

ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF) . ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS) [1].

Product Specifications

Product Name Alternative

ASAM/CLMP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asam-clmp-protein-human-hek293-his.html

Purity

95.0

Smiles

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMHHHHHH

Molecular Formula

79827 (Gene_ID) Q9H6B4 (T19-M233) (Accession)

Molecular Weight

Approximately 35.0 kDa

References & Citations

[1]Elena Ortiz-Zapater, et al. CAR: A key regulator of adhesion and inflammation. Int J Biochem Cell Biol. 2017 Aug;89:1-5.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTP14C siRNA Oligos set (Human)
49391171 3x 5 nmol

UTP14C siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human Lambda Light Chain Rabbit Polyclonal Antibody
DP027-05 500 µL

Human Lambda Light Chain Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cpt1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4650405 3x 1.0 µg

Cpt1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MSL2 Antibody (N-term) Blocking Peptide
MBS9222504-01 0.5 mg

MSL2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
MSL2 Antibody (N-term) Blocking Peptide
MBS9222504-02 5x 0.5 mg

MSL2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
LSM11 Rabbit Polyclonal Antibody (APC)
orb2581503 100 µg

LSM11 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details