Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAM-1, Human (HEK293, His)

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Human (HEK293, His) is the recombinant human-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DNAM-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnam-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Molecular Formula

10666 (Gene_ID) Q15762 (E19-N247) (Accession)

Molecular Weight

43-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS263467-01 48 Well

Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS263467-02 96 Well

Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS263467-03 5x 96 Well

Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS263467-04 10x 96 Well

Goat pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
JAK1, phosphorylated (Tyr1034/Tyr1035)
524569-01 100 µL

JAK1, phosphorylated (Tyr1034/Tyr1035)

Sign In for Pricing
View Details
JAK1, phosphorylated (Tyr1034/Tyr1035)
524569-02 200 µL

JAK1, phosphorylated (Tyr1034/Tyr1035)

Sign In for Pricing
View Details