Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2) . Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-mouse-hek293-his.html

Purity

97.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Formula

19215 (Gene_ID) NP_032989.2 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR562255 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
SLC25A13 Rabbit Polyclonal Antibody
TA365017 100 µL

SLC25A13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SMOC2 activation kit by CRISPRa
GA111969 1 Kit

Human SMOC2 activation kit by CRISPRa

Sign In for Pricing
View Details
4930519G04Rik Mouse Gene Knockout Kit (CRISPR)
KN500386 1 Kit

4930519G04Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tribromoacetonitrile
TRC-T771700-5MG 5 mg

Tribromoacetonitrile

Sign In for Pricing
View Details
Rfxap Mouse Gene Knockout Kit (CRISPR)
KN514714 1 Kit

Rfxap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details