Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2) . Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-mouse-hek293-his.html

Purity

97.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Formula

19215 (Gene_ID) NP_032989.2 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT47A6 (NM_001080141) Human Over-expression Lysate
LC421597 20 µg

CT47A6 (NM_001080141) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Goat Anti-Mouse and CF®594 Tyramide
#33009 1 Kit

Tyramide Amplification Kit with HRP Goat Anti-Mouse and CF®594 Tyramide

Sign In for Pricing
View Details
YKL-40 / CHI3L1 Mouse monoclonal Antibody [10C1]
EM1902-14-50UL 50 µL

YKL-40 / CHI3L1 Mouse monoclonal Antibody [10C1]

Sign In for Pricing
View Details
DISP2 Human Gene Knockout Kit (CRISPR)
KN423141 1 Kit

DISP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiotensin Converting Enzyme (ACE1) Activity Assay Kit
E-BC-K003-M-01 48 T (46 samples)

Angiotensin Converting Enzyme (ACE1) Activity Assay Kit

Sign In for Pricing
View Details
Angiotensin Converting Enzyme (ACE1) Activity Assay Kit
E-BC-K003-M-02 96 T (94 samples)

Angiotensin Converting Enzyme (ACE1) Activity Assay Kit

Sign In for Pricing
View Details