Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2) . Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-mouse-hek293-his.html

Purity

97.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Formula

19215 (Gene_ID) NP_032989.2 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx2 (NM_001106877) Rat Tagged ORF Clone Lentiviral Particle
RR208808L3V 200 µL

Rfx2 (NM_001106877) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fruit fly Nnp-1 Rabbit Polyclonal Antibody (Biotin)
orb2571063 200 µL

Fruit fly Nnp-1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human KLRD1 Protein Lysate
MBS8414172-01 0.02 mg

Human KLRD1 Protein Lysate

Sign In for Pricing
View Details
Human KLRD1 Protein Lysate
MBS8414172-02 5x 0.02 mg

Human KLRD1 Protein Lysate

Sign In for Pricing
View Details
Astn2 (NM_019514) Mouse Tagged Lenti ORF Clone
MR223104L3 10 µg

Astn2 (NM_019514) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bromuconazole 1000 ug/mL in HPLC Acetone - 1ML
LCS-6007 1 mL

Bromuconazole 1000 ug/mL in HPLC Acetone - 1ML

Sign In for Pricing
View Details