Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2) . Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-mouse-hek293-his.html

Purity

97.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Formula

19215 (Gene_ID) NP_032989.2 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Fluoro-3- (4-piperidinyl) -1,2-benzisoxazole
F5275 1 g

6-Fluoro-3- (4-piperidinyl) -1,2-benzisoxazole

Sign In for Pricing
View Details
Lentiviral human NFXL1 sgRNA gene knockout kit - Lentiviral human NFXL1 sgRNA gene knockout kit (plasmid)
GTR15363695 1 Vial

Lentiviral human NFXL1 sgRNA gene knockout kit - Lentiviral human NFXL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ROR alpha Antibody
35333 100 µL

ROR alpha Antibody

Sign In for Pricing
View Details
RITA1 Human Pre-designed siRNA Set A
HY-RS12005 1 Set

RITA1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
6-Fluoro-1,2,3,4-tetrahydro-1-propylquinoxaline
PC1001097 100 mg

6-Fluoro-1,2,3,4-tetrahydro-1-propylquinoxaline

Sign In for Pricing
View Details
MME Protein Vector (Rat) (pPM-C-HA)
PV282560 500 ng

MME Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details