Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD2 Synthase/PTGDS, Mouse (HEK293, His)

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2) . Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgd2-synthase-ptgds-protein-mouse-hek293-his.html

Purity

97.00

Smiles

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

Molecular Formula

19215 (Gene_ID) NP_032989.2 (Q25-E189) (Accession)

Molecular Weight

Approximately 26-32 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLC γ1 (E-12) FITC
sc-7290 FITC 200 µg/mL

PLC γ1 (E-12) FITC

Sign In for Pricing
View Details
TAS2R60 siRNA (Human)
MBS8234085-01 15 nmol

TAS2R60 siRNA (Human)

Sign In for Pricing
View Details
TAS2R60 siRNA (Human)
MBS8234085-02 30 nmol

TAS2R60 siRNA (Human)

Sign In for Pricing
View Details
TAS2R60 siRNA (Human)
MBS8234085-03 5x 30 nmol

TAS2R60 siRNA (Human)

Sign In for Pricing
View Details
Complement component C7
AP78637-01 50 µg

Complement component C7

Sign In for Pricing
View Details
Complement component C7
AP78637-02 100 µg

Complement component C7

Sign In for Pricing
View Details