Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome P450 2C9 (CYP2C9)

Product Specifications

Product Name Alternative

(R) -limonene 6-monooxygenase ((S) -limonene 6-monooxygenase) ((S) -limonene 7-monooxygenase) (CYPIIC9) (Cholesterol 25-hydroxylase1 Publication) (Cytochrome P-450MP) (Cytochrome P450 MP-4) (Cytochrome P450 MP-8) (Cytochrome P450 PB-1) (S-mephenytoin 4-hydroxylase) (CYP2C10)

Abbreviation

Recombinant Human CYP2C9 protein

Gene Name

CYP2C9

UniProt

P11712

Expression Region

1-162aa

Organism

Homo sapiens (Human)

Target Sequence

MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This enzyme contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.4 kDa

References & Citations

"Nucleotide sequence of a human liver cytochrome P-450 related to the rat male specific form." Yasumori T., Kawano S., Nagata K., Shimada M., Yamazoe Y., Kato R. J. Biochem. 102:1075-1082 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF568 conjugate, 0.1mg/mL
BNC681481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL
BNC042873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF740 conjugate, 0.1mg/mL
BNC742868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF405S conjugate, 0.1mg/mL
BNC042217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details