Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calreticulin (Calr)

Product Specifications

Product Name Alternative

CRP55Calregulin; Endoplasmic reticulum resident protein 60 ; ERp60HACBP

Abbreviation

Recombinant Mouse Calr protein

Gene Name

Calr

UniProt

P14211

Expression Region

18-416aa

Organism

Mus musculus (Mouse)

Target Sequence

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Calcium-binding chaperone that promotes folding, oligomeric assbly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.3 kDa

References & Citations

Structural and functional relationships between the lectin and arm domains of calreticulin.Pocanschi C.L., Kozlov G., Brockmeier U., Brockmeier A., Williams D.B., Gehring K.J. Biol. Chem. 286:27266-27277 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSL (Ab-552) Antibody
8B0437-AAT 50 µg

HSL (Ab-552) Antibody

Sign In for Pricing
View Details
TNFAIP2 Human Gene Knockout Kit (CRISPR)
KN424842 1 Kit

TNFAIP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF568 conjugate, 0.1mg/mL
BNC680014-500 1x 500 µL

CD31 / PECAM-1 (C31.7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS628393 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Gasdermin D (GSDMD) Rabbit Monoclonal Antibody [Clone ID: R06-5C5]
TA384336 100 µL

Gasdermin D (GSDMD) Rabbit Monoclonal Antibody [Clone ID: R06-5C5]

Sign In for Pricing
View Details
Mouse IgG3 Isotype Control
AM08210FC-N 100 Tests

Mouse IgG3 Isotype Control

Sign In for Pricing
View Details