Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anionic trypsin, Dog (His-SUMO)

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin Protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Anionic trypsin Protein, Dog (His-SUMO), Dog, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/anionic-trypsin-protein-dog-his-sumo.html

Smiles

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

Molecular Formula

100686744 (Gene_ID) P06872 (I24-S247) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM37 AAV Vector (Mouse) (CMV)
47043104 1 µg

TMEM37 AAV Vector (Mouse) (CMV)

Ask
View Details
Lentiviral mouse Samt2 shRNA (UAS) - Lentiviral mouse Samt2 shRNA (UAS, iRFP) (100)
GTR15280947 1 Vial

Lentiviral mouse Samt2 shRNA (UAS) - Lentiviral mouse Samt2 shRNA (UAS, iRFP) (100)

Ask
View Details
TJP2 (NM_201629) Human Tagged Lenti ORF Clone
RC223155L4 10 µg

TJP2 (NM_201629) Human Tagged Lenti ORF Clone

Ask
View Details
TIMP2 Over-expression Lysate Product
GWB-EFAFA4 0.1 mg

TIMP2 Over-expression Lysate Product

Ask
View Details
Malic enzyme 1 Rabbit Polyclonal Antibody
E28PT2629 100 µL

Malic enzyme 1 Rabbit Polyclonal Antibody

Ask
View Details