Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, Fc)

TNFRSF3/LTBR Protein, Human (HEK293, Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, Fc) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a Fc tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-ltbr-protein-human-hek-293-fc.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

Approximately 65.0 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VATF Rabbit Polyclonal Antibody
E28PN1512 100 µL

VATF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Snrpd2 (NM_026943) Mouse Recombinant Protein
E45M49012M5 20 µg

Snrpd2 (NM_026943) Mouse Recombinant Protein

Sign In for Pricing
View Details
POR Antibody
orb1338299 100 µg

POR Antibody

Sign In for Pricing
View Details
ACAT2 Mouse Monoclonal Antibody [Clone 7B1]
E45M09832V-2 50 µL

ACAT2 Mouse Monoclonal Antibody [Clone 7B1]

Sign In for Pricing
View Details
NCoA-3 (F-2) : m-IgG Fc BP-HRP Bundle
sc-526482 1 Kit

NCoA-3 (F-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Mouse ARL6IP6 Protein, His (Fc)-Avi-tagged
ARL6IP6-729M 50 µg

Recombinant Mouse ARL6IP6 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details